PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10156A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 321aa    MW: 35443.7 Da    PI: 6.2515
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10156AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-183178148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT eEd+llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Oropetium_20150105_10156A 31 RGPWTVEEDLLLVNYIAAHGEGRWNALARGAGLKRTGKSCRLRWLNYL 78
                               89********************************************97 PP

2Myb_DNA-binding52.51.2e-1684127146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rg++T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Oropetium_20150105_10156A  84 RGNMTAQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 127
                                89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8262678IPR017930Myb domain
SuperFamilySSF466892.25E-3029125IPR009057Homeodomain-like
SMARTSM007171.1E-153080IPR001005SANT/Myb domain
PfamPF002499.4E-173178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-223285IPR009057Homeodomain-like
CDDcd001671.46E-113378No hitNo description
PROSITE profilePS5129423.46779133IPR017930Myb domain
SMARTSM007175.2E-1583131IPR001005SANT/Myb domain
PfamPF002491.9E-1584127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2286131IPR009057Homeodomain-like
CDDcd001674.40E-1186127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MKKMAAARDQ RREISMSSED ESSPVSGDLR RGPWTVEEDL LLVNYIAAHG EGRWNALARG  60
AGLKRTGKSC RLRWLNYLRP DLRRGNMTAQ EQLLILELHS RWGNRWSKIA QHLPGRTDNE  120
IKNYWRTRVQ KHARQLNCDV NSQQFKDLMR YLWMPRLLER INNSSSSSLS DDGGVLTPPP  180
PPPQQQLPVP AAWSADDEAH LALLANNEAE LSSSATAASS SSVSTDGVTK QQQPLVSNAG  240
DWSSCYQPPQ TTMTGYPLPA ATHQFGAAGE TCWSDEVYSP AGLSAPAGVV YGGDMAAWPD  300
LGETMWGTDD LWYTQIMGCL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24281314106B-MYB
1h8a_C4e-242813124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1205511e-149AK120551.1 Oryza sativa Japonica Group cDNA clone:J013130B13, full insert sequence.
GenBankCT8306631e-149CT830663.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA128H09, full insert sequence.
GenBankJF9519091e-149JF951909.1 Triticum aestivum clone TaMYB26 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958743.11e-109PREDICTED: myb-related protein 330-like
TrEMBLK3ZVF31e-109K3ZVF3_SETIT; Uncharacterized protein
STRINGSi030584m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-80myb domain protein 112